Antimicrobial and
Adhesive Peptides

Antimicrobial Peptides

Antimicrobial peptides (AMPs) are a class of structurally diverse molecules that are produced by a wide variety of multicellular organisms. These peptides have been demonstrated to eliminate bacteria, yeasts, fungi, viruses and in some cases even cancerous cells. Their broad spectrum of biological activities is the result of their unique amino acid composition and structural conformation. Most AMPs consist of 12-80 amino acids with amphipathic properties that interact with the outer cell wall of gram-negative bacteria and with the cell membrane of gram-positive bacteria.

Binding and permeabilization of the bilayer membrane leads to leakage of cell components and cell death. Because of their antimicrobial effects AMPs play an important role in the development of new generation of antibiotics and pesticides, but also increasingly in the keeping of farm animals, aquaculture, production of modern cosmetics, preservatives for the food industry or technical substances such as coatings.

Our offering of antimicrobial peptides by name

Acidocin A

KTYYGTNGVHCTKKSLWGKVRLKNVIPGTLCRKQSLPIKQDLKILLGWATGAFGKTFH

Armadillidin

GHLGRPYIGGGGGFNRGGGFHRGGGFHRGGGFHSGGGFHRGGGFHSGGSFGYR

Bactericidin B-2

WNPFKELERAGQRVRDAVISAAPAVATVGQAAAIARG

Buforin I

AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY

Catestatin

SSMKLSFRARAYGFRGPGPQL

cgMolluscidin

AATAKKGAKKADAPAKPKKATKPKSPKKAAKKAGAKKGVKRAGKKGAKKTTKAKK

Cryptonin

GLLNGLALRLGKRALKKIIKRLCR

Dermcidin-1L

SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

Gm-mlpA

KVNANAIKKGGKAIGKGFKVISAASTAHDVYEHIKNRRH

Ginkbilobin

ANTAFVSSAHNTQKIPAGAPFNRNLRAMLADLRQNAAFAG

Gm anionic pept2

ETESTPDYLKNIQQQLEEYTKNFNTQVQNAFDSDKIKSEVNNFIESLGKILNTEKKEAPK

Gomesin

QCRRLCYKQRCVTYCRGR

Human beta defensin 3

GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

human Histatin 3

DSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN

human Histatin 5

DSHAKRHHGYKRKFHEKHHSHRGY

Hyastatin

ESFLKSKTGYQGVQTLPGFIGGSQPHLGGGIGGGRPFISQPNLGGGIGGGIGGGKPFIPQPNLGGGIGSTRPFPRPQYGDYGSRNSCNRQCPSTYGGRGICCRRWGSCCPTNYK

LCI

AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYEVWDRK

LL37

[LL-37, 37 aa]

Lycotoxin I

IWLTALKFLGKHAAKHLAKQQLSKL

Macaque histatin

DSHEERHHGRHGHHKYGRKFHEKHHSHRGYRSNYLYDN

Magainin-St1

GLKEVAHSAKKFAKGFISGLTGS

Maximin 1

GIGTKILGGVKTALKGALKELASTYAN

mCRAMP

GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ

Mundticin KS

KYYGNGVSCNKKGCSVDWGKAIGIIGNNSAANLATGGAAGWKS

Polybia-MPI

IDWKKLLDAAKQIL

Royalisin

VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKVGCICRKTSFKDLWDKRF

ParasinI

KGRGKQGGKVRAKAKTRSS

Pleurocidin

GWGSFFKKAAHVGKHVGKAALTHYL

NRC-03

GRRKRKWLRRIGKGVKIIGGAALDHL

Anal R(Pleurocidin)

RWRSFFKKAAHRGKHVGKRARTHYL

H2A rainbow trout

SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAVKAK

FenchiPen5 Peptide

QGYKSGHTGPYPRPLYGSRPIGLRPITRPDPSCAGCRILTLDDAIACCRRLGRCCSALKG

Our offering of antimicrobial peptides by target organisms

  • Fungi
  • Alternaria brassicola
  • Aspergillus fumigatus
  • Beauveria bassiana
  • Botrytis cinerea
  • Candida spp.
  • Coprinus comatus
  • Cryptococcus neoformans
  • Fusarium spp.
  • Mycosphaerella arachidicola
  • Nectria haematococca
  • Neurospora crassa
  • Rhizoctonia solani
  • Rhodotorula rubra
  • Saccharomyces cerevisiae
  • Trichoderma viridae
  • Trichophyton mentagrophytes
  • Trichosporon beigelii
  • Gram (+)
  • Aerococcus viridans
  • Bacillus spp.
  • Enterococcus spp.
  • Lactobacillus spp.
  • Listeria monocytogenes
  • Micrococcus luteus
  • Nocardia asteroides
  • Pediococcus spp.
  • Propionibacterium sp.
  • Planococcus citreus
  • Rhodococcus equi
  • Renibacterium salmoninarum
  • Staphylococcus spp.
  • Streptococcus spp.
  • Corynebacterium glutamicum
  • Trichophyton mentagrophytes
  • Trichosporon beigelii
  • Gram (-)
  • Aeromonas spp.
  • Agrobacterium tumefaciens
  • Enterobacter cloacae
  • Escherichia coli
  • Erwinia carotovora
  • Pseudomonas spp.
  • Salmonella spp.
  • Serratia marcescens
  • Klebsiella pneumoniae
  • Proteus mirabilis
  • Xanthomonas campestris
  • Acinetobacter baumannii
  • Citrobacter freundii
  • Vibrio alginolyticus
  • Trichoderma viridae
  • Trichophyton mentagrophytes
  • Trichosporon beigelii

Adhesive Peptides

Coming in 2019.