Antimikrobielle und
Adhäsive Peptide

Antimikrobielle Peptide

Antimikrobielle Peptide (AMPs) sind eine Klasse strukturell vielseitiger Moleküle, die von einer großen Anzahl mehrzellulärer Organismen produziert werden. Es wurde gezeigt, dass diese Peptide Bakterien, Hefen, Pilze, Viren und im manchen Fällen sogar krebsartige Zellen eliminieren können. Ihr breites Spektrum an biologischer Aktivität ist ein Resultat ihre einzigartigen Zusammensetzung und Struktur von Aminosäuren. Die meisten AMPs bestehen aus 12 bis 80 Aminosäuren mit amphipatischen Eigenschaften

, welche mit den Zellwänden unterschiedlicher Mikroorganismen interagieren. Bindung und Permeabilisierung führen zur Zelllyse. Aufgrund ihrer antimikrobiellen Eigenschaften spielen AMPs eine wichtige Rolle bei der Entwicklung einer neuen Generation von Antibiotika, aber auch zunehmend in den Bereichen Nutztierhaltung, Aquakulturen, Kosmetika, Konservierungsmittel und technische Applikationen wie Beschichtungen.

Unser Angebot an antimikrobiellen Peptiden, sortiert nach Namen

Acidocin A

KTYYGTNGVHCTKKSLWGKVRLKNVIPGTLCRKQSLPIKQDLKILLGWATGAFGKTFH

Armadillidin

GHLGRPYIGGGGGFNRGGGFHRGGGFHRGGGFHSGGGFHRGGGFHSGGSFGYR

Bactericidin B-2

WNPFKELERAGQRVRDAVISAAPAVATVGQAAAIARG

Buforin I

AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY

Catestatin

SSMKLSFRARAYGFRGPGPQL

cgMolluscidin

AATAKKGAKKADAPAKPKKATKPKSPKKAAKKAGAKKGVKRAGKKGAKKTTKAKK

Cryptonin

GLLNGLALRLGKRALKKIIKRLCR

Dermcidin-1L

SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

Gm-mlpA

KVNANAIKKGGKAIGKGFKVISAASTAHDVYEHIKNRRH

Ginkbilobin

ANTAFVSSAHNTQKIPAGAPFNRNLRAMLADLRQNAAFAG

Gm anionic pept2

ETESTPDYLKNIQQQLEEYTKNFNTQVQNAFDSDKIKSEVNNFIESLGKILNTEKKEAPK

Gomesin

QCRRLCYKQRCVTYCRGR

Human beta defensin 3

GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

human Histatin 3

DSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN

human Histatin 5

DSHAKRHHGYKRKFHEKHHSHRGY

Hyastatin

ESFLKSKTGYQGVQTLPGFIGGSQPHLGGGIGGGRPFISQPNLGGGIGGGIGGGKPFIPQPNLGGGIGSTRPFPRPQYGDYGSRNSCNRQCPSTYGGRGICCRRWGSCCPTNYK

LCI

AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYEVWDRK

LL37

[LL-37, 37 aa]

Lycotoxin I

IWLTALKFLGKHAAKHLAKQQLSKL

Macaque histatin

DSHEERHHGRHGHHKYGRKFHEKHHSHRGYRSNYLYDN

Magainin-St1

GLKEVAHSAKKFAKGFISGLTGS

Maximin 1

GIGTKILGGVKTALKGALKELASTYAN

mCRAMP

GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ

Mundticin KS

KYYGNGVSCNKKGCSVDWGKAIGIIGNNSAANLATGGAAGWKS

Polybia-MPI

IDWKKLLDAAKQIL

Royalisin

VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKVGCICRKTSFKDLWDKRF

ParasinI

KGRGKQGGKVRAKAKTRSS

Pleurocidin

GWGSFFKKAAHVGKHVGKAALTHYL

NRC-03

GRRKRKWLRRIGKGVKIIGGAALDHL

Anal R(Pleurocidin)

RWRSFFKKAAHRGKHVGKRARTHYL

H2A rainbow trout

SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAVKAK

FenchiPen5 Peptide

QGYKSGHTGPYPRPLYGSRPIGLRPITRPDPSCAGCRILTLDDAIACCRRLGRCCSALKG

Unser Angebot an antimikrobiellen Peptiden hinsichtlich ihrer Zielorganismen

  • Fungi
  • Alternaria brassicola
  • Aspergillus fumigatus
  • Beauveria bassiana
  • Botrytis cinerea
  • Candida spp.
  • Coprinus comatus
  • Cryptococcus neoformans
  • Fusarium spp.
  • Mycosphaerella arachidicola
  • Nectria haematococca
  • Neurospora crassa
  • Rhizoctonia solani
  • Rhodotorula rubra
  • Saccharomyces cerevisiae
  • Trichoderma viridae
  • Trichophyton mentagrophytes
  • Trichosporon beigelii
  • Gram (+)
  • Aerococcus viridans
  • Bacillus spp.
  • Enterococcus spp.
  • Lactobacillus spp.
  • Listeria monocytogenes
  • Micrococcus luteus
  • Nocardia asteroides
  • Pediococcus spp.
  • Propionibacterium sp.
  • Planococcus citreus
  • Rhodococcus equi
  • Renibacterium salmoninarum
  • Staphylococcus spp.
  • Streptococcus spp.
  • Corynebacterium glutamicum
  • Trichophyton mentagrophytes
  • Trichosporon beigelii
  • Gram (-)
  • Aeromonas spp.
  • Agrobacterium tumefaciens
  • Enterobacter cloacae
  • Escherichia coli
  • Erwinia carotovora
  • Pseudomonas spp.
  • Salmonella spp.
  • Serratia marcescens
  • Klebsiella pneumoniae
  • Proteus mirabilis
  • Xanthomonas campestris
  • Acinetobacter baumannii
  • Citrobacter freundii
  • Vibrio alginolyticus
  • Trichoderma viridae
  • Trichophyton mentagrophytes
  • Trichosporon beigelii

Adhäsive Peptide

Ab 2019!